Informations

Pourquoi les protéines transmembranaires sont-elles difficiles à cristalliser ?


je sais que in vivo il y a beaucoup moins de protéines transmembranaires en général, et qu'elles sont produites à un taux inférieur à leurs homologues libres. Ceci est principalement dû au fait que les protéines transmembranaires ne sont nécessaires que dans un espace 2D sur la membrane plutôt que dans un espace cytoplasmique ou extracellulaire 3D. Cela (encore une fois, très largement) signifie que la probabilité qu'ils interagissent avec leur cible est plus élevée.

Je sais également que c'est l'une des raisons pour lesquelles la production de cristaux pour la cristallographie aux rayons X est notoirement difficile pour les protéines transmembranaires. Quelles sont les autres raisons pour lesquelles les protéines transmembranaires sont généralement des candidats difficiles à la cristallisation ?

Quelle partie spécifique du processus de cristallisation donne de si faibles taux de réussite de l'élucidation de la structure des protéines transmembranaires ?


Plusieurs facteurs rendent plus difficile l'obtention de structures cristallines à partir de protéines membranaires. En bref, presque toutes les étapes d'obtention de la structure par cristallographie sont plus difficiles.

D'abord: expression des protéines. De grandes quantités de protéines pures et bien repliées sont nécessaires et cela est beaucoup plus difficile à réaliser qu'avec une protéine soluble. Étant donné que les protéines membranaires sont liées à l'intérieur d'une membrane, les mécanismes pour traduire le peptide dans la membrane et pour replier la protéine dans la membrane sont différents. Ils peuvent impliquer des facteurs de repliement qui ne sont disponibles que dans un compartiment particulier de la cellule (rendant les bactéries impossibles en tant que système d'expression). En grande quantité dans la cellule, leur caractère hydrophobe pourrait avoir tendance à produire des amas de protéines dépliées au lieu de paraisons de protéines associées à la membrane.

Prochain: Purifier la protéine est plus difficile. Les cellules d'expression sont généralement brisées en présence de détergent pour faire flotter les protéines sous forme de protéines individuelles dans les micelles de détergent. Les mauvais détergents peuvent briser la protéine membranaire et elle peut perdre son pli - la concentration de détergent doit être soigneusement gérée et maintenue à des niveaux optimaux ou les micelles pourraient se briser et la protéine sera ruinée.

Cristalliser la protéine est aussi un peu plus difficile. Les protéines membranaires dans les micelles détergentes qui peuvent ou non être chargées elles-mêmes ressemblent à des taches huileuses avec, espérons-le, un domaine ou deux de protéines repliées qui en sortent. Par rapport à une protéine soluble avec une belle surface ordonnée dans toutes les directions au lieu d'une micelle détergente qui pourrait subir un changement de phase à haute concentration ou par l'ajout d'un sel ou un changement de pH, les protéines membranaires assument une tâche qui peut nécessiter des milliers d'essais et ajoute de nouvelles dimensions à s'inquiéter.

Les protéines sont de type 2D, mais les cristaux doivent toujours être en 3D pour que la cristallographie fonctionne généralement. Les cristaux de protéines sont petits, mais ceux dérivés des protéines membranaires - qui ont tendance à s'organiser en plans comme les membranes qu'ils habitent - sont souvent minces, ce qui peut les rendre trop délicats et petits pour obtenir un bon ensemble de données, même à partir de faisceaux synchrotron. En conséquence, les cristaux sont généralement trop petits ou trop fins pour être utilisés au début, ce qui nécessite une optimisation approfondie une fois le premier cristal trouvé.

Dans quelques cas, certaines protéines membranaires ont été résolues avec des cristaux 2D en utilisant la microscopie électronique sur des réseaux cristallins de porines et de rhodopsines dans les membranes. C'était une tonne de travail, mais ils étaient les premières structures de protéines membranaires depuis des années et des années.

Ne pas rendre tout ce son impossible - une fois que vous avez des cristaux, ils peuvent généralement être améliorés ; il existe de bons points de départ pour la cristallisation et la purification avec des détergents. C'est juste qu'un processus qui peut déjà prendre pas mal de temps (des années) et qui peut parfois se terminer par la frustration prend encore plus de temps et est moins sûr avec une protéine membranaire.


Protéine transmembranaire

Les protéines membranaires, comme toutes les protéines, ont des durées de vie finies. La durée de vie d'une protéine est contrôlée par la vitesse de synthèse et la vitesse de dégradation. La dégradation est dominée par deux phénomènes : le ciblage de la protéine pour l'élimination, souvent par protéolyse par un système déclenché via la voie de l'ubiquitine, et la dénaturation de la protéine (qui peut alors conduire au ciblage et à la protéolyse). Comprendre la dénaturation d'une protéine nécessite une compréhension globale de la stabilité de la protéine (la dénaturation, telle qu'elle sera utilisée ici, est la perte de structure secondaire et tertiaire concomitante à la perte de fonction).

Certaines protéines solubles dans l'eau, dans des conditions soigneusement définies, peuvent être dénaturées, y compris une perte de fonction, puis renaturées avec un gain de fonction. Les observations expérimentales de ce type de comportement ont conduit au concept que ces protéines dans un environnement aqueux étaient à ou près de leur point d'énergie libre globale la plus faible dans leur structure native. Bien qu'il y ait eu beaucoup de discussions sur le paysage d'énergie libre vécu par ces protéines, il ne fait aucun doute que l'énergie libre indique qu'une telle protéine expérimentée dans un environnement aqueux particulier peut être perdue et récupérée dans une expérience de dénaturation/renaturation.

Les protéines membranaires doivent être suffisamment flexibles pour permettre les changements de conformation requis pour leur fonction biologique. Cependant, la structure doit être suffisamment stable pour éviter une dénaturation prématurée. De plus, la structure de la protéine membranaire n'est pas seulement conçue pour s'adapter à la bicouche lipidique mais aussi probablement stabilisée par la bicouche lipidique.

Par conséquent, les protéines transmembranaires, dans pratiquement tous les cas étudiés jusqu'à présent, présentent des caractéristiques de stabilité significativement différentes des protéines solubles. Si la discussion se limite aux protéines transmembranaires construites sur des faisceaux hélicoïdaux dans le domaine transmembranaire, alors les expériences disponibles indiquent que la dénaturation de ces protéines est irréversible (certaines protéines membranaires -baril peuvent être dénaturées et renaturées, mais leurs propriétés de solubilité sont différentes en raison de la pores souvent polaires du tonneau ). 49 L'effet hydrophobe et la structure de ces protéines transmembranaires annoncent ce résultat. Pour se dénaturer, c'est-à-dire perdre leur structure secondaire et tertiaire, les hélices transmembranaires doivent se déplier et ainsi rompre toutes les liaisons hydrogène intérieures. Ces liaisons hydrogène intrahélicoïdales stabilisent les groupes polaires N–H et C–O des liaisons peptidiques à l'intérieur hydrophobe de la membrane. La rupture de ces liaisons laisse ces groupes polaires exposés dans un milieu hydrophobe. Ceci est thermodynamiquement défavorable. De même, l'élimination de la protéine transmembranaire de la membrane vers le milieu aqueux, qui permettrait la liaison hydrogène de ces groupes à l'eau, exposerait simultanément les chaînes latérales d'acides aminés hydrophobes à l'eau, également thermodynamiquement défavorable. Par conséquent, la perte de structure secondaire dans le domaine transmembranaire est peu probable dans un événement de thermodénaturation, jusqu'à ce que des températures extrêmes soient atteintes.

Les résultats les plus probables de la dénaturation thermique à des températures modestes incluent : (1) l'expansion dans le plan de la bicouche (les bicouches hautement ordonnées inhibent la dénaturation des protéines membranaires), (2) l'agrégation dans le plan de la membrane, et (3) la perte de structure dans les domaines extramembranaires de la protéine. Une faible perte de structure hélicoïdale dans le domaine transmembranaire est observée dans les expériences CD sur la dénaturation des protéines transmembranaires. Des observations expérimentales indiquent que la protéine membranaire ainsi traitée ne peut pas être facilement ramenée à son état natif.

La stabilité des protéines membranaires peut être explorée expérimentalement en utilisant la calorimétrie différentielle à balayage. 50,51 Ces expériences montrent que la dénaturation induite par la chaleur de la protéine membranaire est irréversible. Cela signifie que la thermodynamique d'équilibre ne peut pas être utilisée pour comprendre de telles transitions car la thermodynamique d'équilibre nécessite une réversibilité microscopique de la réaction. Cependant, les énergies d'activation pour les transitions peuvent être déterminées. Les expériences ont révélé qu'au moins certaines protéines membranaires sont stabilisées cinétiquement et non thermodynamiquement. Ils ne sont pas au minimum en énergie libre. Ils sont probablement à un minimum local, mais pas à un minimum global, dans le paysage énergétique. Il est probable que la condition favorise les fonctions biologiques que présentent ces protéines membranaires. Il permet une flexibilité conformationnelle considérable (pour les changements conformationnels requis dans les réactions enzymatiques) sans dénaturation alors que la protéine est dans une bicouche lipidique.

Ces expériences déterminent également une durée de vie pour l'état actif de la protéine membranaire. En supposant une réaction de dénaturation de premier ordre, ces protéines membranaires se désintègrent jusqu'à un état inactif avec une demi-vie définie. Dans cette optique, les membranes fournissent un environnement spécialisé pour la protéine membranaire qui optimise la fonction de la protéine membranaire avec le prix d'accompagnement que la protéine membranaire a une durée de vie finie dans cet état optimisé.


G4. Prédiction de la structure des protéines membranaires

  • Contribution de Henry Jakubowski
  • Professeur (Chimie) au Collège de St. Benedict/St. John's University

Jusqu'à présent, nous avons discuté des protéines principalement globulaires qui sont solubles dans l'eau. On trouve également des protéines associées aux membranes. On trouve dans la nature deux grandes classes de protéines membranaires.

  • protéines membranaires périphériques : protéines hydrosolubles liées de manière réversible et non covalente à la membrane par des attractions électrostatiques entre les têtes polaires chargées des phospholipides et la protéine. Ces protéines peuvent souvent être libérées de la membrane par addition de sel élevé, car elles sont souvent attirées vers la bicouche par des interactions électrostatiques entre les groupes de tête phospholipidiques chargés et les groupes polaires/chargés à la surface de la protéine.
  • protéines membranaires intégrales : s'insèrent réellement dans la bicouche. Ceux-ci peuvent être libérés de la membrane et efficacement solubilisés par l'ajout d'amphiphiles à chaîne unique (détergents) qui forment une micelle mélangée avec la protéine membranaire intégrale. Les détergents non ioniques (Trition X-100, octylglucoside, etc.) sont souvent utilisés dans la purification des protéines membranaires. Les détergents ioniques (comme le SDS) non seulement solubilisent les protéines membranaires intégrales, mais les dénaturent également.

Figure : Types de protéines membranaires

Dans certaines de ces protéines membranaires intégrales, de grands domaines extracellulaires et intracellulaires de la protéine sont présents, reliés par les régions intramembranaires. La région couvrante intramembranaire se compose souvent soit d'une seule hélice alpha, soit de 7 régions hélicoïdales différentes qui zigzaguent à travers la membrane. Ces séquences transmembranaires peuvent être facilement déterminées par des calculs d'hydropathie. Par exemple, considérons la rhodopsine de protéine bovine membranaire intégrale. Sa séquence de 348 acides aminés (en code à une seule lettre) est illustrée ci-dessous :

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLY
VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG
GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP
EGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQES
ATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV
YNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA

Les calculs du tracé de l'hydropathie de la rhodopsine montrent qu'il contient sept hélices transmembranaires qui s'enroulent à travers la membrane en serpentin.

Figure : Graphique de l'hydropathie à la rhodopsine

Figure : sept hélices transmembranaires

Résultats de l'hydropathie à la rhodopsine

Non. Borne N région transmembranaire Borne C taper longueur
1 40 LAAYMFLLIMLGFPINFLTLYVT 62 PRIMAIRE 23
2 71 PLNYILLNLAVADLFMVFGGFTT 93 SECONDAIRE 23
3 113 EGFFATLGGEIALWSLVVLAIER 135 SECONDAIRE 23
4 156 GVAFTWVMALACAAPPLVGWSRY 178 SECONDAIRE 23
5 207 MFVVHFIIPLIVIFFCYGQLVFT 229 PRIMAIRE 23
6 261 FLICWLPYAGVAFYIFTHQGSDF 283 PRIMAIRE 23
7 300 VYNPVIYIMMNKQFRNCMVTTLC 322 SECONDAIRE 23

En résumé, les tracés d'hydropathie sont donc utiles pour trouver des régions enfouies dans des protéines hydrosolubles, des hélices transmembranaires dans des protéines membranaires intégrales ainsi que de courtes étendues d'acides aminés polaires/chargés qui pourraient former des boucles de surface reconnaissables par les anticorps du système immunitaire. La taille de la fenêtre utilisée dans les graphiques d'hydropathie affecterait évidemment les résultats calculés. Des fenêtres de 20 acides aminés sont utiles pour déterminer les hélices transmembranaires tandis que des fenêtres de 5 à 7 acides aminés sont utilisées pour trouver des sites hydrophiles exposés en surface.

Les protéines membranaires doivent être solubilisées par addition d'amphiphiles monocaténaires (détergents). Les queues non polaires des détergents interagissent avec le domaine transmembranaire hydrophobe de la protéine membranaire formant une structure de type micellaire "mixte". Les détergents non ioniques comme le Triton X-100 et l'octyl-glucoside sont souvent utilisés pour solubiliser les protéines membranaires dans leur état quasi natif. En revanche, les détergents ioniques comme le dédécyle sulfate de sodium (avec un groupe de tête chargé négativement) dénaturent les protéines pendant le processus de solubilisation. Pour étudier les protéines membranaires dans un environnement plus natif, les protéines solubilisées par un détergent non ionique peuvent être reconstituées en structures de liposomes bicouches en utilisant des méthodes similaires à celles du laboratoire 1 dans lesquelles vous avez préparé de grandes vésicules unilamellaires (LUV) encapsulées dans un colorant. Cependant, il peut être difficile d'étudier les domaines intra- et extracellulaires des protéines membranaires dans les liposomes, étant donné que l'un de ces domaines est caché à l'intérieur du liposome. Une nouvelle technique qui supprime cette barrière a été récemment développée par Sligar. Il a créé un disque de protéine amphiphile avec une ouverture au centre. L'ouverture intérieure est tapissée de résidus non polaires, tandis que la surface extérieure du disque est polaire. Lorsque les disques ont été ajoutés aux phosphlipides, de petites bicouches se sont formées à l'intérieur du disque. Des protéines membranaires telles que le récepteur adrénergique b-2 pourraient être reconstituées dans les bicouches du nanodisque, permettant une exposition au solvant des domaines intracellulaires et extracellulaires de la protéine réceptrice.


Protéines membranaires

4 Type I. Hélice transmembranaire simple : glycophorine

Étant donné que les érythrocytes, contrairement à d'autres cellules humaines, n'ont pas de membranes internes compliquées et sont facilement obtenus sous forme pure à partir du sang, ils ont servi pendant des décennies de "laboratoire pour les études sur les membranes". Bon nombre des études biochimiques et biophysiques membranaires classiques discutées dans les chapitres suivants ont d'abord été réalisées sur les érythrocytes, et de nombreuses études sur les protéines membranaires ont d'abord été réalisées sur la glycophorine résidente. Cependant, malgré le fait que la glycophorine soit l'une des protéines membranaires les plus étudiées, sa fonction biologique reste incertaine. Les glycophorines a et b sont les principales glycoprotéines de la membrane plasmique des érythrocytes et portent les déterminants antigéniques des groupes sanguins MN et Ss. En poids, 60% de la glycophorine est un glucide qui est entièrement attaché à la surface externe du feuillet de la protéine. Les acides sialiques abondants (chapitre 7) confèrent une charge négative à la surface externe des érythrocytes. Les charges négatives sur la glycophorine font que les érythrocytes se repoussent les uns les autres, les empêchant de s'agglomérer dans le sang. Avec l'âge, la perte de sucres déclenche la destruction des vieux érythrocytes.

La glycophorine a est une protéine intégrale à travée unique de 131 acides aminés dont la structure cartoon est représentée sur la figure 6.7 [19] . Tous les glucides de la glycophorine sont attachés aux acides aminés sur le segment extérieur N-terminal. Ces glucides ne sont attachés qu'à quelques-uns des 50 premiers acides aminés de la séquence extérieure de 80 acides aminés de la glycophorine. Comme pour le cytochrome b5, ce segment extracellulaire peut être clivé par la trypsine. Les tétrasaccharides de sucre attachés sont liés par O à la sérine ou à la thréonine, tandis que les oligosaccharides plus gros sont liés par N aux asparagines. La sérine et la thréonine liées à l'O et l'asparagine liée à l'azote sont la manière habituelle de lier les sucres aux protéines membranaires (chapitre 7). La glycophorine a est maintenue dans la membrane via une hélice transmembranaire transmembranaire de 22 acides aminés [20] . Enfin, la glycophorine a a un segment C-terminal de 29 acides aminés qui s'étend dans l'espace aqueux à l'intérieur des érythrocytes. Ce segment est totalement dépourvu de sucres. Les domaines non membranaires N-terminaux et C-terminaux ont de nombreux acides aminés hydrophiles qui ne se trouvent pas dans le segment d'hélice transmembranaire. La glycophorine a est verrouillée en place par une hélice qui est flanquée des acides aminés chargés positivement, la lysine et l'arginine. Ces acides aminés cationiques interagissent avec les groupes de tête phospholipidiques chargés négativement. Dans la membrane érythrocytaire, la glycophorine a existe probablement sous forme de dimères qui forment une structure enroulée impliquant les hélices .

Graphique 6.7. Structure de bande dessinée de la glycophorine montrant des domaines extracellulaires (N-terminal), transmembranaire (α-hélice) et intracellulaire (C-terminal) [19] .


Biologie structurale des récepteurs couplés aux protéines G : nouvelles opportunités des XFEL et cryoEM

Les progrès récents de la cryoEM et des XFEL ont accéléré les études structurelles des GPCR.

Les XFEL ont permis de créer des structures sans dommage à température ambiante à partir de cristaux de la taille d'un micromètre.

CryoEM a démontré son potentiel pour élucider les complexes de signalisation GPCR.

Les cryoEM et les XFEL promettent tous deux de faire la lumière sur la dynamique structurelle des GPCR.

Les récepteurs couplés aux protéines G assurent la médiation de la signalisation cellulaire et régulent la majorité des processus sensoriels et physiologiques du corps humain. Des percées récentes dans la cryomicroscopie électronique et les lasers à électrons libres à rayons X ont accéléré les études structurelles des récepteurs difficiles à cristalliser et de leurs complexes de signalisation, et ont ouvert de nouvelles opportunités pour comprendre la dynamique conformationnelle et visualiser le processus d'activation des récepteurs avec une technologie spatiale sans précédent. et la résolution temporelle. Ici, nous résumons les principales étapes et défis associés à l'application de ces techniques et décrivons les orientations futures de leur développement en mettant l'accent sur la biologie structurale des protéines membranaires.


Cours 2 - analyse de la structure et de la fonction des protéines membranaires

Cristallographie aux rayons X = est utilisé pour déterminer/identifier l'arrangement précis des atomes dans un cristal d'un échantillon de votre protéine d'intérêt. En fin de compte pour résoudre la structure tridimensionnelle des macromolécules biologiques telles que les protéines est déterminée par diffraction des rayons X.
Les rayons X offrent la meilleure résolution pour déterminer la structure moléculaire dite que sa longueur d'onde correspond à la longueur d'onde d'une liaison covalente. Ainsi, une faible longueur d'onde du rayonnement X est nécessaire pour une meilleure résolution afin de pouvoir atteindre une résolution de 2-3 A. Cette résolution entre cette plage est importante pour déterminer les résidus d'acides aminés et les chaînes latérales d'une protéine.

-La régularité est maintenue dans le cristal car les molécules sont orientées dans un arrangement fixe et régulier les unes par rapport aux autres qui ont toutes la même structure 3D et la même taille. La cristallisation des protéines est assez difficile pour obtenir une solution concentrée d'un échantillon de protéines très pures. Comme les modifications de la taille des cristaux affecteront le schéma de diffraction qui est utilisé pour déterminer avec précision la structure de la protéine membranaire.

-pH, température et autre paramètre affectant la cristallisation - tous ont par la suite pour effet la capacité de faire croître des cristaux d'une qualité suffisante (une solution concentrée de protéine très pure)

-Origine et interprétation du motif de diffraction (loi de Bragg - une loi de la physique qui montre que les rayons de diffraction rebondissent sur les structures cristallines).

-Traitement du diagramme de diffraction (la transformée de Fourier est l'ajout de différentes ondes sinusoïdales pour calculer la structure à l'aide de la carte de densité électronique, la densité d'électrons dans l'espace réel)


5. Sursaturation, nucléation et croissance des cristaux  

La cristallisation de toute molécule, ou la collection de certaines espèces chimiques, y compris les protéines, se déroule en deux étapes assez distinctes mais indissociables : la nucléation et la croissance. La nucléation est le problème le plus difficile à résoudre théoriquement et expérimentalement car elle représente une transition de phase de premier ordre par laquelle les molécules passent d'un état totalement désordonné à un état ordonné. Vraisemblablement, cela se produit par la formation d'intermédiaires partiellement ordonnés ou paracristallins, dans ce cas des agrégats de protéines ayant un ordre à courte distance, et donne finalement de petits assemblages complètement ordonnés que nous appelons noyaux critiques.

Les noyaux critiques doivent être considérés en termes de dimensions moléculaires, de sursaturation et d'énergie libre de surface d'addition moléculaire. Actuellement, la taille nucléaire critique n'a été décrite que pour quelques systèmes, et pour plusieurs cas ceux-ci n'ont été étudiés qu'en termes de noyaux bidimensionnels se développant à la surface de cristaux déjà existants (Malkin et al., 1996 ▶, 1997 ▶). Récemment, une théorie a émergé qui tente d'expliquer le phénomène de nucléation en termes de fluctuations statistiques des propriétés de la solution (Ten Wolde & Frenkel, 1997 ▶ Haas & Drenth, 1999 ▶ Piazza, 1999 ▶ Kuznetsov et al., 1998 ▶). Cette idée soutient qu'une ‘phase protéique liquide distinctive se forme dans les solutions de protéines concentrées et que cette ‘phase’ donne finalement naissance à des noyaux critiques avec un ordre complet. Cette idée est maintenant à l'étude en utilisant une variété de techniques expérimentales dans de nombreux laboratoires.

La croissance des cristaux macromoléculaires est un processus mieux caractérisé que la nucléation, et ses mécanismes sont raisonnablement bien compris. Les cristaux de protéines se développent principalement par les mécanismes classiques de croissance des dislocations et de croissance par nucléation bidimensionnelle, ainsi que par deux autres mécanismes moins courants appelés croissance normale et nucléation tridimensionnelle (Malkin et al., 1995 ▶ McPherson & Malkin, 2000 ▶). Une caractéristique commune de la nucléation et de la croissance est que les deux dépendent de manière critique de ce que l'on appelle la sursaturation de la liqueur mère donnant naissance aux cristaux. La sursaturation est la variable qui pilote les deux processus et détermine leur occurrence et leur étendue ainsi que la cinétique qui les régit.

La cristallisation d'une macromolécule nécessite absolument la création d'un état sursaturé. Ceci est illustré par le diagramme de phase pour la croissance cristalline présenté sur la figure 3 ▶ . La sursaturation est une condition de non-équilibre dans laquelle une certaine quantité de la macromolécule dépassant la limite de solubilité, dans des conditions chimiques et physiques spécifiques, est néanmoins présente en solution. L'équilibre est rétabli par la formation et le développement d'un état solide, tel que des cristaux, lorsque la limite de saturation est atteinte. Pour produire la solution sursaturée, les propriétés d'une solution sous-saturée doivent être modifiées pour réduire la capacité du milieu à solubiliser la macromolécule (c'est à dire. réduire son activité chimique), ou une propriété des macromolécules doit être modifiée pour réduire leur solubilité et/ou pour augmenter l'attraction d'une macromolécule pour une autre. Dans tous les cas, les relations entre solvant et soluté, ou entre les macromolécules en solution, sont perturbées de manière à favoriser la formation de l'état solide.

Le diagramme de phase pour la cristallisation des macromolécules. Le diagramme de solubilité est divisé nettement en une région de sous-saturation et une région de sursaturation par la ligne indiquant la solubilité maximale à des concentrations spécifiques d'un précipitant, qui peut être un sel ou un polymère. La ligne représente l'équilibre entre l'existence de la phase solide et la phase de molécule libre. La région de sursaturation est en outre divisée de manière plus incertaine en régions métastables et labiles. Dans la région métastable, les noyaux se développeront en cristaux, mais aucune nucléation ne se produira. Dans la région labile, on peut s'attendre à ce que les deux se produisent. La région finale, à très haute sursaturation, est désignée par région de précipitation, où ce résultat pourrait être le plus probable. Les cristaux ne peuvent être cultivés qu'à partir d'une solution sursaturée, et la création d'une telle solution sursaturée dans la protéine d'intérêt est l'objectif immédiat de la croissance des cristaux de protéine.

Si aucun cristal ou autre solide n'est présent lorsque les conditions sont modifiées, le soluté ne se divisera pas immédiatement en deux phases et la solution restera à l'état sursaturé. L'état solide ne se développe pas nécessairement spontanément lorsque la limite de saturation est dépassée car une énergie, analogue à l'énergie d'activation d'une réaction chimique, est nécessaire pour créer la deuxième phase : le noyau stable d'un cristal, ou un précipité. Ainsi, une barrière cinétique ou énergétique (ou de probabilité) permet aux conditions de s'éloigner de l'équilibre et de pénétrer plus avant dans la zone de sursaturation. Une fois qu'un noyau stable apparaît dans une solution sursaturée, il continuera à croître jusqu'à ce que le système retrouve l'équilibre. Tant que des forces de non-équilibre prévalent et qu'un certain degré de sursaturation existe pour entraîner les événements, un cristal se développera ou un précipité se formera.


Contenu

Lipoprotéines transmembranaires Modifier

Certains protéolipides transmembranaires, en particulier ceux trouvés dans les bactéries, sont appelés lipoprotéines, ils ne sont pas liés aux particules de lipoprotéines dont traite cet article. [2] De telles protéines transmembranaires sont difficiles à isoler, car elles se lient étroitement à la membrane lipidique, nécessitent souvent des lipides pour afficher la structure appropriée et peuvent être insolubles dans l'eau. Des détergents sont généralement nécessaires pour isoler les lipoprotéines transmembranaires de leurs membranes biologiques associées.

Particules de lipoprotéines plasmatiques Modifier

Les graisses étant insolubles dans l'eau, elles ne peuvent pas être transportées seules dans l'eau extracellulaire, y compris le plasma sanguin. Au lieu de cela, ils sont entourés d'une coque externe hydrophile qui fonctionne comme un véhicule de transport. Le rôle des particules de lipoprotéines est de transporter les molécules de graisse, telles que les triacylglycérols (également appelés triglycérides), les phospholipides et le cholestérol dans l'eau extracellulaire du corps vers toutes les cellules et tous les tissus du corps. Les protéines incluses dans l'enveloppe externe de ces particules, appelées apolipoprotéines, sont synthétisées et sécrétées dans l'eau extracellulaire par les cellules de l'intestin grêle et du foie. L'enveloppe externe contient également des phospholipides et du cholestérol.

Toutes les cellules utilisent et dépendent des graisses et du cholestérol comme éléments constitutifs pour créer les multiples membranes que les cellules utilisent à la fois pour contrôler la teneur en eau interne et les éléments internes hydrosolubles et pour organiser leur structure interne et leurs systèmes enzymatiques protéiques. L'enveloppe externe des particules de lipoprotéines a les groupes hydrophiles de phospholipides, de cholestérol et d'apolipoprotéines dirigés vers l'extérieur. De telles caractéristiques les rendent solubles dans le pool sanguin à base d'eau salée. Les triacylglycérols et les esters de cholestérol sont transportés à l'intérieur, protégés de l'eau par l'enveloppe extérieure. Le type d'apolipoprotéines contenues dans l'enveloppe externe détermine l'identité fonctionnelle des particules de lipoprotéines. L'interaction de ces apolipoprotéines avec des enzymes dans le sang, entre elles ou avec des protéines spécifiques à la surface des cellules, détermine si les triacylglycérols et le cholestérol seront ajoutés ou retirés des particules de transport des lipoprotéines.

Caractérisation dans le plasma humain [3]

Chylomicrons VLDL LDL HDL
Mobilité électrophorétique Origine Pré-bêta Bêta Alpha
Densité moins de 0,96 0.96-1.006 1.006-1.063 1.063-1.21
Diamètre (nm) 100-1000 30-90 20-25 10-20
Apolipoprotéines B48, Al, Tout B100 CI, CI B100 IA, AII, CI
Composition
(% du contenu total)
Protéine 2 10 20 40
Lipide 98 90 80 60
Composant lipidique
(% de la teneur totale en lipides)
Triacylglycérols 88 55 12 12
Esters de cholestérol 4 24 59 40
Phospholipides 8 20 28 47
Acides gras libres - 1 1 1

Les lipoprotéines sont des particules complexes qui ont un noyau hydrophobe central de lipides non polaires, principalement des esters de cholestéryle et des triglycérides. Ce noyau hydrophobe est entouré d'une membrane hydrophile constituée de phospholipides, de cholestérol libre et d'apolipoprotéines. Les lipoprotéines plasmatiques sont divisées en sept classes en fonction de la taille, de la composition lipidique et des apolipoprotéines. [4]

Métabolisme Modifier

La manipulation des particules de lipoprotéines dans le corps est appelée métabolisme des particules de lipoprotéines. Elle se divise en deux voies, exogène et endogène, selon en grande partie si les particules lipoprotéiques en question sont composées principalement de lipides alimentaires (exogènes) ou si elles proviennent du foie (endogène), par synthèse de novo de triacylglycérols.

Les hépatocytes sont la principale plate-forme pour la manipulation des triacylglycérols et du cholestérol. Le foie peut également stocker certaines quantités de glycogène et de triacylglycérols. Alors que les adipocytes sont les principales cellules de stockage des triacylglycérols, ils ne produisent pas de lipoprotéines.

Voie exogène Modifier

La bile émulsionne les graisses contenues dans le chyme, puis la lipase pancréatique clive les molécules de triacylglycérol en deux acides gras et un 2-monoacylglycérol. Les entérocytes absorbent facilement les petites molécules du chymus. À l'intérieur des entérocytes, les acides gras et les monoacylglycérides sont à nouveau transformés en triacylglycérides. Ensuite, ces lipides sont assemblés avec l'apolipoprotéine B-48 en chylomicrons naissants. Ces particules sont ensuite sécrétées dans les lactés dans un processus qui dépend fortement de l'apolipoprotéine B-48. En circulant dans les vaisseaux lymphatiques, les chylomicrons naissants contournent la circulation hépatique et sont drainés par le canal thoracique dans la circulation sanguine.

Dans la circulation sanguine, particules de chylomicrons naissantes interagir avec les particules HDL, ce qui entraîne un don de HDL d'apolipoprotéine C-II et d'apolipoprotéine E au chylomicron naissant. Le chylomicron à ce stade est alors considéré comme mature. Via l'apolipoprotéine C-II, les chylomicrons matures activent la lipoprotéine lipase (LPL), une enzyme présente sur les cellules endothéliales qui tapissent les vaisseaux sanguins. La LPL catalyse l'hydrolyse du triacylglycérol qui libère finalement le glycérol et les acides gras des chylomicrons. Le glycérol et les acides gras peuvent alors être absorbés dans les tissus périphériques, en particulier les tissus adipeux et musculaires, pour l'énergie et le stockage.

Les chylomicrons hydrolysés sont maintenant appelés restes de chylomicrons. Les restes de chylomicrons continuent de circuler dans la circulation sanguine jusqu'à ce qu'ils interagissent via l'apolipoprotéine E avec les récepteurs des restes de chylomicrons, que l'on trouve principalement dans le foie. Cette interaction provoque l'endocytose des restes de chylomicrons, qui sont ensuite hydrolysés au sein des lysosomes. L'hydrolyse lysosomale libère du glycérol et des acides gras dans la cellule, qui peuvent être utilisés pour l'énergie ou stockés pour une utilisation ultérieure.

Voie endogène Modifier

Le foie est la plate-forme centrale de manipulation des lipides : il est capable de stocker les glycérols et les graisses dans ses cellules, les hépatocytes. Les hépatocytes sont également capables de créer des triacylglycérols via la synthèse de novo. Ils produisent également la bile à partir du cholestérol. Les intestins sont responsables de l'absorption du cholestérol. Ils le transfèrent dans la circulation sanguine.

Dans les hépatocytes, les triacylglycérols et les esters de cholestérol sont assemblés avec l'apolipoprotéine B-100 pour former particules VLDL naissantes. Les particules de VLDL naissantes sont libérées dans la circulation sanguine via un processus qui dépend de l'apolipoprotéine B-100.

Dans la circulation sanguine, particules VLDL naissantes en conséquence, les particules HDL donnent de l'apolipoprotéine C-II et de l'apolipoprotéine E à la particule VLDL naissante. Une fois chargée d'apolipoprotéines C-II et E, la particule de VLDL naissante est considérée comme mature. Les particules VLDL circulent et rencontrent la LPL exprimée sur les cellules endothéliales. L'apolipoprotéine C-II active la LPL, provoquant l'hydrolyse de la particule VLDL et la libération de glycérol et d'acides gras. Ces produits peuvent être absorbés à partir du sang par les tissus périphériques, principalement adipeux et musculaires. Les particules de VLDL hydrolysées sont maintenant appelées restes de VLDL ou lipoprotéines de densité intermédiaire (IDL). Les restes de VLDL peuvent circuler et, via une interaction entre l'apolipoprotéine E et le récepteur des restes, être absorbés par le foie, ou ils peuvent être davantage hydrolysés par la lipase hépatique.

L'hydrolyse par la lipase hépatique libère du glycérol et des acides gras, laissant derrière Restes IDL, appelées lipoprotéines de basse densité (LDL), qui contiennent une teneur en cholestérol relativement élevée [5] (voir structure LDL native à 37°C sur YouTube). Le LDL circule et est absorbé par le foie et les cellules périphériques. La liaison de LDL à son tissu cible se produit par une interaction entre le récepteur LDL et l'apolipoprotéine B-100 sur la particule LDL. L'absorption se fait par endocytose et les particules de LDL internalisées sont hydrolysées au sein des lysosomes, libérant des lipides, principalement du cholestérol.

Rôle possible dans le transport de l'oxygène Modifier

Les lipoprotéines plasmatiques peuvent transporter de l'oxygène gazeux. [6] Cette propriété est due à la structure hydrophobe cristalline des lipides, fournissant un environnement approprié pour O2 solubilité par rapport à un milieu aqueux. [7]

Rôle dans l'inflammation Modifier

L'inflammation, une réponse du système biologique à des stimuli tels que l'introduction d'un agent pathogène, joue un rôle sous-jacent dans de nombreuses fonctions et pathologies biologiques systémiques. Il s'agit d'une réponse utile du système immunitaire lorsque le corps est exposé à des agents pathogènes, tels que des bactéries dans des endroits qui s'avéreront nocifs, mais qui peuvent également avoir des effets néfastes s'ils ne sont pas régulés. Il a été démontré que les lipoprotéines, en particulier les HDL, jouent un rôle important dans le processus inflammatoire. [8]

Lorsque le corps fonctionne dans des conditions physiologiques normales et stables, le HDL s'est avéré bénéfique de plusieurs manières. [8] Le LDL contient de l'apolipoprotéine B (apoB), qui permet au LDL de se lier à différents tissus, tels que la paroi artérielle si le glycocalyx a été endommagé par une glycémie élevée. [8] S'ils sont oxydés, les LDL peuvent être piégés dans les protéoglycanes, empêchant leur élimination par l'efflux de cholestérol HDL. [8] Le fonctionnement normal des HDL est capable d'empêcher le processus d'oxydation des LDL et les processus inflammatoires ultérieurs observés après l'oxydation. [8]

Le lipopolysaccharide, ou LPS, est le principal facteur pathogène de la paroi cellulaire des bactéries à Gram négatif. Les bactéries à Gram positif ont un composant similaire appelé acide lipotéichoïque ou LTA. Le HDL a la capacité de lier le LPS et le LTA, créant des complexes HDL-LPS pour neutraliser les effets nocifs dans le corps et éliminer le LPS du corps. [9] Le HDL joue également un rôle important en interagissant avec les cellules du système immunitaire pour moduler la disponibilité du cholestérol et moduler la réponse immunitaire. [9]

Dans certaines conditions physiologiques anormales telles qu'une infection systémique ou une septicémie, les principaux composants des HDL sont modifiés [9] [10] La composition et la quantité de lipides et d'apolipoprotéines sont modifiées par rapport aux conditions physiologiques normales, telles qu'une diminution du cholestérol HDL. (HDL-C), des phospholipides, de l'apoA-I (une lipoprotéine majeure des HDL dont il a été démontré qu'elle possède des propriétés anti-inflammatoires bénéfiques) et une augmentation de l'amyloïde sérique A. [9] [10] Cette composition altérée des HDL est communément appelé HDL de phase aiguë dans une réponse inflammatoire de phase aiguë, au cours de laquelle le HDL peut perdre sa capacité à inhiber l'oxydation du LDL. [8] En fait, cette composition altérée des HDL est associée à une mortalité accrue et à de moins bons résultats cliniques chez les patients atteints de sepsis. [9]

Par densité Modifier

Les lipoprotéines peuvent être classées en cinq groupes principaux, classés de la densité plus grande et plus faible à la densité plus petite et plus élevée. Les lipoprotéines sont plus grosses et moins denses lorsque le rapport graisse/protéine est augmenté. Ils sont classés sur la base de l'électrophorèse, de l'ultracentrifugation et de la spectroscopie de résonance magnétique nucléaire via l'analyseur Vantera. [11]

    transporter les triglycérides (graisses) des intestins au foie, aux muscles squelettiques et au tissu adipeux. (VLDL) transportent les triglycérides (nouvellement synthétisés) du foie vers le tissu adipeux. (IDL) sont intermédiaires entre VLDL et LDL. Ils ne sont généralement pas détectables dans le sang à jeun. (LDL) transportent 3 000 à 6 000 molécules de graisse (phospholipides, cholestérol, triglycérides, etc.) dans tout le corps. Les particules de LDL sont parfois appelées "mauvaises" lipoprotéines parce que les concentrations, liées à la dose, sont en corrélation avec la progression de l'athérosclérose.
    • grosses particules flottantes de LDL (lb LDL)
    • small dense LDL (sd LDL) particles is a lipoprotein particle of a certain phenotype

    For young healthy research subjects,

    70 kg (154 lb), these data represent averages across individuals studied, percentages represent % dry weight:

    Density (g/mL) Classer Diameter (nm) % protein % cholesterol & cholesterol ester % phospholipid % triacylglycerol
    >1.063 HDL 5–15 33 30 29 4-8
    1.019–1.063 LDL 18–28 25 46-50 21-22 8-10
    1.006–1.019 IDL 25–50 18 29 22 31
    0.95–1.006 VLDL 30–80 10 22 18 50
    <0.95 Chylomicrons 75-1200 1-2 8 7 83-84

    [12] [13] However, these data are not necessarily reliable for any one individual or for the general clinical population.

    Alpha and beta Edit

    It is also possible to classify lipoproteins as "alpha" and "beta", according to the classification of proteins in serum protein electrophoresis. This terminology is sometimes used in describing lipid disorders such as abetalipoproteinemia.

    Subdivisions Edit

    Lipoproteins, such as LDL and HDL, can be further subdivided into subspecies isolated through a variety of methods. [14] [15] These are subdivided by density or by the protein contents/ proteins they carry. [14] While the research is currently ongoing, researchers are learning that different subspecies contain different apolipoproteins, proteins, and lipid contents between species which have different physiological roles. [14] For example, within the HDL lipoprotein subspecies, a large number of proteins are involved in general lipid metabolism. [14] However, it is being elucidated that HDL subspecies also contain proteins involved in the following functions: homeostasis, fibrinogen, clotting cascade, inflammatory and immune responses, including the complement system, proteolysis inhibitors, acute-phase response proteins, and the LPS-binding protein, heme and iron metabolism, platelet regulation, vitamin binding and general transport. [14]

    Atherosclerosis is the leading cause of coronary artery disease. [16] And, ischaemic heart disease is the leading cause of mortality in the world. [17] Many studies have examined possible correlations between the incidence of the disease and plasma lipoprotein particle concentrations in the blood. Hypotheses exist for possible causations but none have been proven to date. [18] [19] [20] [21] [22] [23] [24] These studies have shown correlation (and correlation does not imply causation [25] ) between atherosclerosis and concentrations of particles. Studies specifically targeting different phenotypes are needed to determine if the amount of particles are a reaction to diet composition. [26] [27] Citizen scientists are attempting to do that. [28]


    2. Differences between CD spectroscopy of soluble and membrane proteins

    2.1 Effects of fold characteristics of membrane proteins on spectral properties

    Fig. 1 Circular dichroism spectra typical of membrane proteins composed of different secondary structural types: predominantly antiparallel alpha-helical bundle (red: a sodium channel pore 48 ) predominantly beta-barrel (blue: BTUB outer membrane cobalamin transporter 23 ), mixed helical, beta sheet and unordered structure (green: WZA translocon for capsular polysaccharides 23 ). The CD spectra correspond to PCDDB 47 IDs CD0004012000, CD0000102000, CD0000128000, respectively. Inset are the crystal structures (PDB IDs 4F4L, 1NQE, and 2J58, respectively) of these proteins depicted in the same colour scheme.

    2.2 Effects of environmental and physical characteristics of membrane proteins on spectral properties

    The dielectric constant (∼1–2) of the hydrophobic core of a detergent micelle or phospholipid bilayer in which a membrane protein is embedded is considerably lower than that of water (∼80). This can cause both bathochromic and hypsochromic shifts in the CD spectrum of proteins measured in these environments compared to the spectra of proteins comprised of similar secondary structures but present in aqueous solution. 19,20 The extent and nature of the shift depends on which electronic transition in the peptide is examined, and on the relative location of the peptide bond with respect to the membrane environment. The direction and magnitudes of the shifts are ultimately related to the changes in the energy gap between the ground and excited states of the transitions, and the peak positions can vary substantially between the same type of secondary structure in aqueous solution and in membranes. 21 As the n → π* and π → π* transitions are differentially affected (Fig. 2), the wavelength dependence on solvent dielectric is non-linear and hence cannot be corrected simply by shifting the entire spectrum. Such shifts in peak positions can have significant effects on secondary structure analyses, and tend to produce inaccurate results when using standard deconvolution methods with the commonly-used reference datasets derived from soluble proteins. 21

    2 Demonstration of spectral shifts observed for each of the different electronic transitions in membrane protein spectra relative to those in soluble protein spectra. Membrane proteins (black spectra) and soluble proteins (grey spectra) were selected to have matching secondary structures in each case. 21 Left: Predominantly helical proteins. Right: Predominantly beta sheet proteins. In both examples the arrows indicate the peak positions (in black and grey, respectively) for the membrane and soluble proteins. It is notable that not all of the peaks shift in the same direction, nor to the same extent.
    Fig. 3 Diagram indicating the nature of the phenomenon of light scattering. je 0 is the light incident onto the scattering sample (red circles represent membrane particles). je t is the transmitted light that impinges on the detector and is used to measure the light absorbed by the sample. je s is light scattered in a direction that does not intersect with the detector, and contributes to the additional “apparent” (but not actual) absorbed light. θ is the acceptance angle of the detector and describes the angle of the scattered light that impinges on the detector.
    4 Light scattering effects in CD spectra: 14,15 effects of changing the detector acceptance angle ( θ ). Left: Sample (bacteriorhodopsin in octyl glucoside micelles) that does not exhibit scattering, measured at two different values of θ (2 degrees: dashed line and 90 degrees: solid line). It can be seen that the spectra are essentially identical. Right: Sample (bacteriorhodopsin in purple membranes) that exhibits scattering (2 degrees: dashed line and 90 degrees: solid line). In this case the spectra are very different, both in magnitudes and peak positions of the wavelength maxima/minima.

    The simplest methods involve reducing the size of the particles so they are much smaller (∼1/10) than the wavelengths of the UV light used in the investigation. 14 Most detergent micelles are too small to exhibit substantial scattering in the far UV region of the spectrum. However, there may be some concern about the conformation of a protein in a micellar environment being different from that in a membrane due to the packing constraints imposed by the relative size, shape and charge of the detergent head groups and the length and composition of the hydrophobic tail groups. 25 Hence whilst the dimensions of micelles may be ideal for eliminating scattering, their physical characteristics such as their geometry may have deleterious effect on the protein structure. Furthermore, the functions of many types of membrane proteins ( e.g. ion channels) cannot be assessed in micelles so there is no way to ensure their structure is not perturbed.

    Small unilamellar vesicles (SUVs) 14,15,26 (∼25 nm diameter) also tend to produce little scattering in the far UV region, and provide another solution. Such samples can be produced by mechanical means such as sonication or extrusion, but in very small vesicles the protein structure may be distorted by the process of producing the vesicles or by the curvature of the membranes. Alternatively the protein can be examined in bicelles, or nanodiscs, which can also have small dimensions relative to the wavelength of light used for CD studies. Again, however, there may be issues associated with protein integrity in such environments, and because the intra- and extra-cellular surfaces are not in separate compartments, some proteins such as channels also cannot be functionally assayed in these types of samples.

    Alternatively, it has been suggested that scattering effects may not preclude all measurements in large lipid unilamellar vesicles (LUVs), a conclusion largely based on comparisons of a soluble protein in the presence and absence of lipid vesicles. 27 However, in the test samples, 27 the scattering particles (LUVs) were not themselves chiral, nor were the chiral objects (proteins) scatterers, meaning that the scattering would be non-chiral, and would naturally not influence the shape of the CD spectrum. 15 Hence this may not have been an entirely suitable test for a chiral membrane protein in a scattering lipid vesicle. Nevertheless, their conclusions 27 that protein CD spectra obtained in the presence of LUVs could be used if the data were limited to wavelengths above 200 (or 215 nm, depending on the size of the LUVs) may provide another option for avoiding the effects of light scattering. However, it is noteworthy that virtually all secondary structure analysis algorithms require the availability of data down to at least 190 nm (due to the number of eigenvectors of information present) 28,29 so quantitative analyses in LUVs would not be accurate, but may be useful for the qualitative examination of large differences in more native-like environments.

    A simple physical solution to the scattering problem is to locate the sample as close to the instrument detector as possible so that the light scattered at relatively large angles can be captured, eliminating the apparent effect on the spectrum. The detector acceptance angle ( θ ) geometry is defined in Fig. 3. Different commercial CD instruments have different default θ angles, but most can be modified to enable large values of θ by moving the sample (or detector) so that the sample cell is adjacent to the detector face. Most SRCD beamlines have this type of geometry as their default. The effectiveness of this procedure depends on the geometry of the scattering object, with empty and filled spheres, filaments, and discs producing very different 3-dimensional scattering profiles. However for “empty spheres” such as lipid vesicles, the scattering is generally within 90 degrees of the forward direction, 14 an angle that can usually be achieved by the appropriate positioning of the cell and detector.

    A practical consideration issue when moving the detector to obviate the scattering measured from the sample is the sample cell geometry. All of the scattered light from a particular angle θ must reach the detector and not be subtended by the side edges of the sample cell. This thus requires the use of circular rather than rectangular cells, as the sides of the latter would intersect some of the scattered light in the forward directions.

    5 Diagram indicating the nature of the phenomenon of absorption flattening. The top panel depicts an isotropic sample, whereas the bottom depicts a membrane sample. The small circles represent proteins, whilst the large circles represent membrane particles. t is the cell pathlength, I 0 is the incident light on each sample. je je is the transmitted light by the isotropic sample, whereas I M is the transmitted light for the membrane sample. je M/ I je = q (the flattening coefficient). In the limit of one protein per membrane, q = 1.
    Fig. 6 Spectra depicting the effects of absorption flattening on the spectra of a membrane protein, bacteriorhodopsin, which has a primarily helical secondary structure. 14 Purple membrane fragments (large particles with low lipid-to-protein ratios, dotted line) where flattening is large, and small unilamellar vesicles (SUVs) (with high lipid-to-protein ratios, solid line) where flattening is negligible. These are compared with the spectrum calculated from the protein crystal structure (dashed line), which would correspond to an “unflattened” spectrum. It clearly matches the SUVs spectrum, but not the spectrum of the membrane fragments.

    The amount of flattening is proportional to the extent of the sample non-uniformity. This would be less problematic if the effect were uniform across the wavelength range of the spectrum, as it could simply be compensated for by a scaling factor. However, this is not the case because absorption (and thus flattening) is a function of the extinction coefficient of the sample at a given wavelength. Hence, the spectrum will not be uniformly flattened at all wavelengths. In an optically active sample the extinction coefficients at a given wavelength are different for left circular polarised light (CPL) and right CPL. As a consequence, the CD peaks are not only depressed with respect to samples at lower concentrations, but further distorted by this differential effect. Differential flattening will be more apparent for CD peaks with higher extinction coefficients (in most cases, this is the electron transition at ∼190 nm). Put simply, the higher the absorbance, the more the flattening, thus not only is the overall spectral magnitude reduced, but also the magnitude of different peaks are reduced by different amounts, thereby distorting the shape of the spectrum. The extent of the flattening will also depend on the relative concentration of the proteins in the particles, with higher concentrations producing more flattening, and also on the geometry of the particles. 31

    An extreme example is the purple membrane containing the membrane protein bacteriorhodopsin, 10,30,31 in which the proteins are close-packed into two-dimensional crystals. Relative to a solution of isolated bacteriorhodopsin molecules, the spectrum of bacteriorhodopsin in purple membranes is not only much smaller, but the more intense peaks at ∼190 and 208 nm are significantly depressed relative to the less intensely absorbing peak at ∼222 nm. When compared with a dispersed sample of the protein in SUVs, or the back-calculated spectrum from the crystal structure, the spectrum of the highly concentrated protein patches is very different 14 (Fig. 6).

    The extent of the flattening ( q ) at any wavelength can be expressed as the ratio of the absorbance (or ellipticity in the case of CD) of the spectrum of the protein in the membrane particle ( A M) divided by absorbance (or ellipticity) of the spectrum of the same protein in a completely dispersed form ( A je).


    2.2.3.2 Solutions/corrections for the phenomenon. Obviously the simplest means of correcting for this phenomenon would be to completely disperse the protein in a form where there was one protein per particle. If the protein can be incorporated into particles (detergent micelles, lipid vesicles, bicelles, amphipols, nanodiscs, or membrane fragments) containing a single protein then the dispersed condition can be met. 30,31 However, that condition is challenging to meet, even for SUVs. It cannot be achieved simply by sonication of larger particles, as decreasing the particle size whilst maintaining the lipid-to-protein ratio will not significantly affect the distribution of absorbing proteins. The complete elimination of flattening in SUVs requires lipid-to-protein molar ratios of around 2000 [see Section 2.3]. However the CD signal from a sample with such a high lipid-to-proteins ratio will generally be compromised by the absorption of the phospholipid carboxyl groups which absorb strongly in the wavelengths of interest. So for membrane proteins there is often a trade-off of concerns for detergent effects versus spectral distortions produced by the particulate nature of lipid membranes.

    2.3 Effects of lipid-to-protein molar ratios

    However, the high light flux of SRCD beamlines [see Section 4.4] (which enables light penetration through relatively opaque samples) can mitigate against these problems by enabling the measurement of SUVs which have lipid-to-protein ratios of 250:1 or even as high as 2000:1. 6


    The SND proteins constitute an alternative targeting route to the endoplasmic reticulum

    In eukaryotes, up to one-third of cellular proteins are targeted to the endoplasmic reticulum, where they undergo folding, processing, sorting and trafficking to subsequent endomembrane compartments. Targeting to the endoplasmic reticulum has been shown to occur co-translationally by the signal recognition particle (SRP) pathway or post-translationally by the mammalian transmembrane recognition complex of 40 kDa (TRC40) and homologous yeast guided entry of tail-anchored proteins (GET) pathways. Despite the range of proteins that can be catered for by these two pathways, many proteins are still known to be independent of both SRP and GET, so there seems to be a critical need for an additional dedicated pathway for endoplasmic reticulum relay. We set out to uncover additional targeting proteins using unbiased high-content screening approaches. To this end, we performed a systematic visual screen using the yeast Saccharomyces cerevisiae, and uncovered three uncharacterized proteins whose loss affected targeting. We suggest that these proteins work together and demonstrate that they function in parallel with SRP and GET to target a broad range of substrates to the endoplasmic reticulum. The three proteins, which we name Snd1, Snd2 and Snd3 (for SRP-independent targeting), can synthetically compensate for the loss of both the SRP and GET pathways, and act as a backup targeting system. This explains why it has previously been difficult to demonstrate complete loss of targeting for some substrates. Our discovery thus puts in place an essential piece of the endoplasmic reticulum targeting puzzle, highlighting how the targeting apparatus of the eukaryotic cell is robust, interlinked and flexible.

    Déclaration de conflit d'intérêts

    Ribosome-profiling data are deposited in Gene Expression Omnibus (GEO) under accession number GSE85686. The authors declare no competing financial interests.

    Les figures

    (a) RFP-Gas1 localization is not affected by mutants in SRP or…

    (a) Snd2 and Snd3 form a complex together with the Sec61…

    669 kDa, and a second supercomplex of a higher molecular mass. We postulate that the two Sec61/SND complexes may differ in size depending on the presence of additional auxiliary components. For gel source data see Supplementary Figure 1. (b) Loss of each SND protein affects the localization of the others Fluorescent micrographs showing that Snd2 is mislocalized upon deletion of SND3 and Snd3 is mislocalized upon deletion of SND1, suggesting a functional dependence between the three proteins. Scale bars throughout figure, 5 μm. (c) Growth rates reveal the genetic interactions between the SND genes Heterozygous diploids of Δsnd were sporulated and tetrad-dissected to retrieve haploids. Tetrads obtained demonstrate an epistatic interaction between SND1 et SND2 mutants, and a synthetic sick interaction between SND3 et le SND1/2 mutants. Comme SND3 is more than an order of magnitude more abundant than SND1/2, it is possible that this interaction is due to an independent cellular function. (d) RFP-Gas1 localization is comparable between SND single and double mutants Fluorescent micrographs of RFP-Gas1 in SND single and double mutants show that they are epistatic to each other in terms of their effect on targeting. (e) Quantification of RFP-Gas1 mis-localization in SND double mutants Quantification of the RFP-Gas1 mislocalization phenotype in SND single and double mutants (Extended Data Fig. 2d) reveals a buffering epistatic interaction between SND genes (100 cells were counted per strain).

    Extended Data Figure 3. Substrate affinity to…

    Extended Data Figure 3. Substrate affinity to a targeting pathway depends on the position of…


    Biochemistry II Chapter 9 Lipids Practice Questions/MC

    I. They protect the contents of the cell from chaotropic agents such as urea.
    II. They are easily dissociated from the membrane by changes in pH or high salt concentration.
    III. They are held tightly in place by hydrophobic effects between the membrane and hydrophobic amino acids.

    I. fatty acids
    II. triacylglycerols
    III. glycerophospholipids
    IV. sphingomyelins

    I. contain a glycerol core with a phosphocholine headgroup.
    II. contain a modified sphingosine.
    III. often function as receptor components of membranes.
    IV. function as a precursor to sterols.

    I. is often used to direct proteins to the lysosome for incorporation into the lysosome.
    II. is usually not used for small eukaryotic proteins.
    III. of some transmembrane proteins is embedded into the membrane as an anchor.
    IV. is usually cleaved off the completed protein.

    I-cell disease results in psychomotor retardation, skeletal deformities and death. Which of the following is true regarding this disease?

    1. Synthesis occurs with a leading signal peptide
    2. The SRP-ribosome complex binds the SRP receptor-translocon complex
    3. The signal peptide binds the SRP and GDP is replaced with GTP
    4. GTP hydrolysis results in dissociation of SRP and SR
    5. SRP changes in conformation arresting peptide growth
    6. The nascent protein begins to fold and post-translational modification is initiated
    7. Signal peptidase cleaves the protein from the signal peptide

    I. Glycogen has greater polarity than fatty acids.
    II. Fatty acids predominate in an anhydrous form
    III. Fatty acids are less oxidized than carbohydrates.
    IV. Triglycerides have a higher average molecular mass.